PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013626m
Common NameCARUB_v10013623mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 469aa    MW: 51090.2 Da    PI: 8.2466
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013626mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.3e-32207263259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK++kg e+prsYY+Ct+ +Cpvkkkvers+ d+++++i+Y+g+H+he
  Carubv10013626m 207 DDGYNWRKYGQKPIKGCEYPRSYYKCTHVNCPVKKKVERSS-DGQITQIIYKGQHDHE 263
                      8****************************************.***************8 PP

2WRKY105.13.7e-33354412159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct+a+C+v+k+ver+++d k+v++tYeg+Hnh+
  Carubv10013626m 354 LDDGYRWRKYGQKVVKGNPHPRSYYKCTTANCTVRKHVERASTDAKAVITTYEGKHNHD 412
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-28199265IPR003657WRKY domain
SuperFamilySSF1182902.22E-25204265IPR003657WRKY domain
SMARTSM007743.4E-35206264IPR003657WRKY domain
PROSITE profilePS5081124.03207265IPR003657WRKY domain
PfamPF031061.5E-24207262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-36339414IPR003657WRKY domain
SuperFamilySSF1182904.18E-29346414IPR003657WRKY domain
PROSITE profilePS5081137.734349414IPR003657WRKY domain
SMARTSM007743.8E-38354413IPR003657WRKY domain
PfamPF031061.6E-25355412IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031347Biological Processregulation of defense response
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MAVEDDVSSS IRTTTLVAPT RPTITVPQRP PAIETAAYFF GGGDGLSLSP GPLSFVSSFF  60
VDSFPDVLTP DNQRTTSSFS QLLAGAMSVS PGAGGGGRST AGMFPGGGPM FTVPSGFSPS  120
SLLTSPIFFP PHQSTAQTSF VQPQPQPHQP QRQDTFSHHM PTSTSTAIHG RQSFEVSQAD  180
QRARNHHNNP ANNSRSYNVV NVDKPADDGY NWRKYGQKPI KGCEYPRSYY KCTHVNCPVK  240
KKVERSSDGQ ITQIIYKGQH DHERPQNRRG GGSRDSVEAG DHIHFVVGGA GHVMESSDDS  300
GYGKDHDDDN NDDDDGDEDL PGSKIRKIDG VSTTHRTVTE PKIIVQTRSE VDLLDDGYRW  360
RKYGQKVVKG NPHPRSYYKC TTANCTVRKH VERASTDAKA VITTYEGKHN HDVPAARNGT  420
AAAGTSDQHR MRSMSGNNMQ QNMSFGSNNN NSGQSPVLLR LKEEKITI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-38207415878Probable WRKY transcription factor 4
2lex_A2e-38207415878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297601.10.0hypothetical protein CARUB_v10013623mg
SwissprotQ93WU70.0WRK58_ARATH; Probable WRKY transcription factor 58
TrEMBLR0HLE10.0R0HLE1_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30000980.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.11e-168WRKY DNA-binding protein 58